Review



ybx1 recombinant protein  (Novus Biologicals)


Bioz Verified Symbol Novus Biologicals is a verified supplier
Bioz Manufacturer Symbol Novus Biologicals manufactures this product  
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 93
      Buy from Supplier

    Structured Review

    Novus Biologicals ybx1 recombinant protein
    Ybx1 Recombinant Protein, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 93/100, based on 13 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/ybx1 recombinant protein/product/Novus Biologicals
    Average 93 stars, based on 13 article reviews
    ybx1 recombinant protein - by Bioz Stars, 2026-03
    93/100 stars

    Images



    Similar Products

    ybx1 recombinant protein  (Novus Biologicals)
    93
    Novus Biologicals ybx1 recombinant protein
    Ybx1 Recombinant Protein, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/ybx1 recombinant protein/product/Novus Biologicals
    Average 93 stars, based on 1 article reviews
    ybx1 recombinant protein - by Bioz Stars, 2026-03
    93/100 stars
    		  Buy from Supplier
    1999 n a recombinant human ybx1 origene cat  (OriGene)
    90
    OriGene 1999 n a recombinant human ybx1 origene cat
    1999 N A Recombinant Human Ybx1 Origene Cat, supplied by OriGene, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/1999 n a recombinant human ybx1 origene cat/product/OriGene
    Average 90 stars, based on 1 article reviews
    1999 n a recombinant human ybx1 origene cat - by Bioz Stars, 2026-03
    90/100 stars
    		  Buy from Supplier
    recombinant human ybx1  (OriGene)
    90
    OriGene recombinant human ybx1
    Recombinant Human Ybx1, supplied by OriGene, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/recombinant human ybx1/product/OriGene
    Average 90 stars, based on 1 article reviews
    recombinant human ybx1 - by Bioz Stars, 2026-03
    90/100 stars
    		  Buy from Supplier
    human ybx1 construct  (Novus Biologicals)
    92
    Novus Biologicals human ybx1 construct
    High confidence TAM-induced protein stability hits.
    Human Ybx1 Construct, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 92/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/human ybx1 construct/product/Novus Biologicals
    Average 92 stars, based on 1 article reviews
    human ybx1 construct - by Bioz Stars, 2026-03
    92/100 stars
    		  Buy from Supplier

    Image Search Results


    High confidence TAM-induced protein stability hits.

    Journal: Journal of proteome research

    Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements

    doi: 10.1021/acs.jproteome.7b00442

    Figure Lengend Snippet: High confidence TAM-induced protein stability hits.

    Article Snippet: SPROX Protocol with Phenacyl Bromide Labelling (PAB-SPROX) A PAB-SPROX experiment was performed on a purified recombinant human YBX1 construct (Novus Biologicals, #NBP2-30101) both in the presence and absence of TAM according to a previously established protocol 23 .

    Techniques: Multiplex sample analysis

    Pulse proteolysis with purified recombinant YBX1 +/− TAM. A) Pulse proteolysis of YBX1 +/− TAM in increasing concentration of urea. Red box depicting TAM-induced difference at 0.75 M Urea. B) Intact YBX1 and pulse proteolysis of YBX1 in the absence of TAM at low and high denaturant.

    Journal: Journal of proteome research

    Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements

    doi: 10.1021/acs.jproteome.7b00442

    Figure Lengend Snippet: Pulse proteolysis with purified recombinant YBX1 +/− TAM. A) Pulse proteolysis of YBX1 +/− TAM in increasing concentration of urea. Red box depicting TAM-induced difference at 0.75 M Urea. B) Intact YBX1 and pulse proteolysis of YBX1 in the absence of TAM at low and high denaturant.

    Article Snippet: SPROX Protocol with Phenacyl Bromide Labelling (PAB-SPROX) A PAB-SPROX experiment was performed on a purified recombinant human YBX1 construct (Novus Biologicals, #NBP2-30101) both in the presence and absence of TAM according to a previously established protocol 23 .

    Techniques: Purification, Recombinant, Concentration Assay

    SPROX data generated on YBX1 +/− TAM. The filled circles represent data generated on the YBX1 peptide RPQYSNPPVQGEVMEGADNQGAGEQGRPVR in the PAB-SPROX analysis of the purified recombinant YBX1 construct. The open circles represent data on the oxidized version of the same YBX1 peptide in the SILAC-SPROX analysis of the unpurified protein in the MCF-7 cell lysate. Both data sets are consistent with a TAM-induced stabilization of YBX1.

    Journal: Journal of proteome research

    Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements

    doi: 10.1021/acs.jproteome.7b00442

    Figure Lengend Snippet: SPROX data generated on YBX1 +/− TAM. The filled circles represent data generated on the YBX1 peptide RPQYSNPPVQGEVMEGADNQGAGEQGRPVR in the PAB-SPROX analysis of the purified recombinant YBX1 construct. The open circles represent data on the oxidized version of the same YBX1 peptide in the SILAC-SPROX analysis of the unpurified protein in the MCF-7 cell lysate. Both data sets are consistent with a TAM-induced stabilization of YBX1.

    Article Snippet: SPROX Protocol with Phenacyl Bromide Labelling (PAB-SPROX) A PAB-SPROX experiment was performed on a purified recombinant human YBX1 construct (Novus Biologicals, #NBP2-30101) both in the presence and absence of TAM according to a previously established protocol 23 .

    Techniques: Generated, Purification, Recombinant, Construct, Multiplex sample analysis

    STRING analysis of the 27 high-confidence TAM and NDT hits. The STRING analysis was conducted using medium confidence data from experiments. Also included in the STRING analysis were the MAPK1, AKT1 and ESR1 (see text). The red dashed line represents an experimentally observed direct interaction between ER and YBX1 that was recently reported in reference.34

    Journal: Journal of proteome research

    Article Title: Discovery of Tamoxifen and N-Desmethyl Tamoxifen Protein Targets in MCF-7 Cells Using Large-Scale Protein Folding and Stability Measurements

    doi: 10.1021/acs.jproteome.7b00442

    Figure Lengend Snippet: STRING analysis of the 27 high-confidence TAM and NDT hits. The STRING analysis was conducted using medium confidence data from experiments. Also included in the STRING analysis were the MAPK1, AKT1 and ESR1 (see text). The red dashed line represents an experimentally observed direct interaction between ER and YBX1 that was recently reported in reference.34

    Article Snippet: SPROX Protocol with Phenacyl Bromide Labelling (PAB-SPROX) A PAB-SPROX experiment was performed on a purified recombinant human YBX1 construct (Novus Biologicals, #NBP2-30101) both in the presence and absence of TAM according to a previously established protocol 23 .

    Techniques: